PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009787917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 421aa    MW: 48075.5 Da    PI: 8.4752
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009787917.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.94.8e-50391651128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s
  XP_009787917.1  39 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPdKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS 132
                     579************************777.99***************778888999************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+k+tLvf+ grapkg++t+W+mhey +
  XP_009787917.1 133 -GSNMIGTKRTLVFHMGRAPKGQRTQWIMHEYCM 165
                     .99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-5636182IPR003441NAC domain
PROSITE profilePS5100553.78739183IPR003441NAC domain
PfamPF023651.3E-2641164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MEDGNVSDEN KATKIVERSK NINGNDKNVE ISVATASTMF PGFRFCPTDE ELISYYLKKK  60
VEGSDKCVEV ISEVEIWKHE PWDLPDKSIV QSDNEWFFFS PRGRKYPNGS QSKRATESGY  120
WKATGKERNV KSGSNMIGTK RTLVFHMGRA PKGQRTQWIM HEYCMTGNTY YQDSVVVCRL  180
RKNNEFHLND THGNRRNHLA NDCATALSGA GQLDSLDLIN GGDCCSKEGS SSFSSHSVEK  240
IESGSESDKL TKELPQHHSS SHWKDCDEED CFADIMKDDI VKLDDSSYKE RHNLLPIVTR  300
KLESSTKSST QEFQDLMSHR LPFQGTANRR LRLQTEIVPR RVERSEVYEA NKKNSRAVGT  360
TRCLMINIIP IRRMKQWSIP LLLVFFALLV IFLCLFGVPQ KVKWLRHLVV ITPAEVNTRP  420
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-443018411169NAC domain-containing protein 19
3swm_B3e-443018411169NAC domain-containing protein 19
3swm_C3e-443018411169NAC domain-containing protein 19
3swm_D3e-443018411169NAC domain-containing protein 19
3swp_A3e-443018411169NAC domain-containing protein 19
3swp_B3e-443018411169NAC domain-containing protein 19
3swp_C3e-443018411169NAC domain-containing protein 19
3swp_D3e-443018411169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-95HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009787917.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1BQC90.0M1BQC9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.11e-82NAC domain containing protein 60